Immunohistochemistry (IHC) : Human yolk sac tumor stained with anti-AFP polyclonal antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of tumor cells..

mouse anti-AFP monoclonal antibody (C3) 6014

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to AFP
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2a
Control: Fetal liver or hepatocellular carcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6014parent Categories: antibody, Zeta IHC antibodies Tags: AFP, anatomy, GI Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2a
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-AFP monoclonal antibody C3 6014

antibody
Database link: human P02771
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Fetal liver or hepatocellular carcinoma
Immunogen Alpha fetoprotein (AFP) purified from serum of a hepatoma patient
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2a
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2a - Isotype Control

target relevance
Homo sapiens AFP Alpha-fetoprotein
Protein names Alpha-fetoprotein
Alternative names Alpha-1-fetoprotein, Alpha-fetoglobulin
Gene names AFP
Protein family Belongs to the ALB/AFP/VDB family
Function Binds copper, nickel, and fatty acids as well as, and bilirubin less well than, serum albumin. Only a small percentage (less than 2%) of the human AFP shows estrogen-binding properties
Subcellular location Secreted
Structure Dimeric and trimeric forms have been found in addition to the monomeric form
Post-translational modification Independent studies suggest heterogeneity of the N-terminal sequence of the mature protein and of the cleavage site of the signal sequence Sulfated
Involvement in disease Alpha-fetoprotein deficiency A benign condition characterized by undetectable AFP levels in the amniotic fluid. Affected individuals are asymptomatic and present normal development. Alpha-fetoprotein, hereditary persistence A benign autosomal dominant condition characterized by continued expression of alpha-fetoprotein in adult life.
Keywords 3D-structure, Copper, Direct protein sequencing, Disulfide bond, Glycoprotein, Metal-binding, Nickel, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Secreted, Signal, Sulfation
Sequence MKWVESIFLIFLLNFTESRTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATY KEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEG RHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILL WAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSLLNQHACAVMKNFGTRTFQAITV TKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKIT ECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSR RHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQ KLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADII IGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQA QGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLI SKTRAALGV
UniProt accession: P02771

Data

Human yolk sac tumor stained with anti-AFP polyclonal antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of tumor cells..

FAQ & Publications

Frequently Asked Questions

What applications is the mouse anti-AFP monoclonal antibody (C3) validated for?

This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.

What is the recommended dilution for the concentrated form of the mouse anti-AFP monoclonal antibody (C3) for IHC?

The recommended dilution range for the concentrated antibody in immunohistochemistry is 1:100 to 1:200.

How should the mouse anti-AFP monoclonal antibody (C3) be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, avoiding repeated freeze/thaw cycles.

Which species does the mouse anti-AFP monoclonal antibody (C3) react with?

This antibody is reactive with human alpha-fetoprotein (AFP).

What is the host species and isotype of the anti-AFP monoclonal antibody (C3)?

The antibody is a mouse monoclonal of the IgG2a isotype.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.