| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | goat |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ELISA, ICC/IF, WB |
| available sizes | 100 µg |
goat anti-ECS (DYDDDDK) tag polyclonal antibody 8522
$426.00
Antibody summary
- Goat polyclonal to DYDDDDK tag
- Suitable for: ELISA
- Reacts with: tagged fusion proteins
- Isotype: IgG
- 100 µg
goat anti-ECS (DYDDDDK) tag polyclonal antibody 8522
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA,IP |
| Recommended dilutions Immunoblotting: use at a dilution of 1:1,000- 1:20,000. Immunocytochemistry: use at a dilution of 1:100-1:400. ELISA: for detection use at a dilution of 1:1,000-1:30,000; for coating use at a dilution of 1:100-1:500. Immunoprecipitation: use 1-4ug/mg lysate These are |
| Immunogen DDDDK conjugated to KLH. |
| Size and concentration 100, 1000µg and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at 2-8°C. |
| Storage buffer PBS, pH 7.2, 0.09% NaN3. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries donkey anti-goat IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 1689 donkey anti-goat IgG, H&L chain specific, biotin conjugated polyclonal antibody 1699 donkey anti-goat IgG, H&L chain specific, FITC conjugated polyclonal antibody 1704 donkey anti-goat IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1709 donkey anti-goat IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1705 |
| Isotype control Goat polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens TMPRSS15 Enteropeptidase |
| Protein names Enteropeptidase |
| Alternative names Enterokinase, Serine protease 7, Transmembrane protease serine 15 |
| Gene names TMPRSS15 |
| Protein family Belongs to the peptidase S1 family |
| Function Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases |
| Catalytic activity Activation of trypsinogen by selective cleavage of 6-Lys-|-Ile-7 bond. |
| Subcellular location Membrane |
| Structure Heterodimer of a catalytic (light) chain and a multidomain (heavy) chain linked by a disulfide bond |
| Post-translational modification The chains are derived from a single precursor that is cleaved by a trypsin-like protease |
| Involvement in disease Enterokinase deficiency Life-threatening intestinal malabsorption disorder characterized by diarrhea and failure to thrive. |
| Keywords 3D-structure, Disulfide bond, Glycoprotein, Hydrolase, Lipoprotein, Membrane, Myristate, Protease, Proteomics identification, Reference proteome, Repeat, Serine protease, Signal-anchor, Transmembrane, Transmembrane helix, Zymogen |
| Sequence MGSKRGISSRHHSLSSYEIMFAALFAILVVLCAGLIAVSCLTIKESQRGAALGQSHEARA TFKITSGVTYNPNLQDKLSVDFKVLAFDLQQMIDEIFLSSNLKNEYKNSRVLQFENGSII VVFDLFFAQWVSDENVKEELIQGLEANKSSQLVTFHIDLNSVDILDKLTTTSHLATPGNV SIECLPGSSPCTDALTCIKADLFCDGEVNCPDGSDEDNKMCATVCDGRFLLTGSSGSFQA THYPKPSETSVVCQWIIRVNQGLSIKLSFDDFNTYYTDILDIYEGVGSSKILRASIWETN PGTIRIFSNQVTATFLIESDESDYVGFNATYTAFNSSELNNYEKINCNFEDGFCFWVQDL NDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEP ACLSFWYHMYGENVHKLSINISNDQNMEKTVFQKEGNYGDNWNYGQVTLNETVKFKVAFN AFKNKILSDIALDDISLTYGICNGSLYPEPTLVPTPPPELPTDCGGPFELWEPNTTFSST NFPNSYPNLAFCVWILNAQKGKNIQLHFQEFDLENINDVVEIRDGEEADSLLLAVYTGPG PVKDVFSTTNRMTVLLITNDVLARGGFKANFTTGYHLGIPEPCKADHFQCKNGECVPLVN LCDGHLHCEDGSDEADCVRFFNGTTNNNGLVRFRIQSIWHTACAENWTTQISNDVCQLLG LGSGNSSKPIFPTDGGPFVKLNTAPDGHLILTPSQQCLQDSLIRLQCNHKSCGKKLAAQD ITPKIVGGSNAKEGAWPWVVGLYYGGRLLCGASLVSSDWLVSAAHCVYGRNLEPSKWTAI LGLHMKSNLTSPQTVPRLIDEIVINPHYNRRRKDNDIAMMHLEFKVNYTDYIQPICLPEE NQVFPPGRNCSIAGWGTVVYQGTTANILQEADVPLLSNERCQQQMPEYNITENMICAGYE EGGIDSCQGDSGGPLMCQENNRWFLAGVTSFGYKCALPNRPGVYARVSRFTEWIQSFLH |
| UniProt accession: P98073 |
Data
 |
| Detection of ECS (DYKDDDDK)-tagged Protein by western blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein.Antibody: Affinity purified goat anti-ECS (DYKDDDDK) antibody 8522 used for WB at 0.04 µg /ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds. |
|
| Detection of ECS (DYKDDDDK)-tagged Protein by western blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein.Antibody: Affinity purified goat anti-ECS (DYKDDDDK) antibody 8522 used for WB at 0.04 µg /ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds. |
FAQ & Publications
Frequently Asked Questions
What applications has the goat anti-ECS (DYDDDDK) tag polyclonal antibody 8522 been tested for?
This antibody has been tested and validated for Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), enzyme-linked immunosorbent assay (ELISA), and immunoprecipitation (IP).
How should the goat anti-ECS (DYDDDDK) antibody 8522 be stored to ensure stability?
The antibody is stable for at least one year when stored at 2-8°C. It is supplied in a PBS buffer at pH 7.2 containing 0.09% sodium azide (NaN3) as a preservative.
What is the recommended dilution range for using this antibody in ELISA assays?
For ELISA detection, the antibody should be used at dilutions ranging from 1:1,000 to 1:30,000. For coating purposes in ELISA, use a dilution between 1:100 and 1:500.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.