| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | goat |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Agarose immobilized, ECS |
| available sizes | 100 µg |
goat anti-Agarose Immobilized ECS polyclonal antibody 5344
$506.00
Antibody summary
- Goat polyclonal to Agarose Immobilized
- Suitable for: IP
- Isotype: Whole IgG
- 100 µg
goat anti-Agarose Immobilized ECS polyclonal antibody 5344
| antibody |
|---|
| Tested applications IP |
| Recommended dilutions Immunoprecipitation: use 15-25ul of gel slurry per 0.1-1mg of protein extract or lysate. These are recommended concentrations. End users should determine optimal concentrations for their applications. |
| Immunogen DDDDK conjugated to KLH. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at 2-8°C. |
| Storage buffer Phosphate Buffered Saline (PBS) containing 0.09 |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries donkey anti-goat IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 1689 donkey anti-goat IgG, H&L chain specific, biotin conjugated polyclonal antibody 1699 donkey anti-goat IgG, H&L chain specific, FITC conjugated polyclonal antibody 1704 donkey anti-goat IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1709 donkey anti-goat IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1705 |
| Isotype control Goat polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens TMPRSS15 Enteropeptidase |
| Protein names Enteropeptidase |
| Alternative names Enterokinase, Serine protease 7, Transmembrane protease serine 15 |
| Gene names TMPRSS15 |
| Protein family Belongs to the peptidase S1 family |
| Function Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases |
| Catalytic activity Activation of trypsinogen by selective cleavage of 6-Lys-|-Ile-7 bond. |
| Subcellular location Membrane |
| Structure Heterodimer of a catalytic (light) chain and a multidomain (heavy) chain linked by a disulfide bond |
| Post-translational modification The chains are derived from a single precursor that is cleaved by a trypsin-like protease |
| Involvement in disease Enterokinase deficiency Life-threatening intestinal malabsorption disorder characterized by diarrhea and failure to thrive. |
| Keywords 3D-structure, Disulfide bond, Glycoprotein, Hydrolase, Lipoprotein, Membrane, Myristate, Protease, Proteomics identification, Reference proteome, Repeat, Serine protease, Signal-anchor, Transmembrane, Transmembrane helix, Zymogen |
| Sequence MGSKRGISSRHHSLSSYEIMFAALFAILVVLCAGLIAVSCLTIKESQRGAALGQSHEARA TFKITSGVTYNPNLQDKLSVDFKVLAFDLQQMIDEIFLSSNLKNEYKNSRVLQFENGSII VVFDLFFAQWVSDENVKEELIQGLEANKSSQLVTFHIDLNSVDILDKLTTTSHLATPGNV SIECLPGSSPCTDALTCIKADLFCDGEVNCPDGSDEDNKMCATVCDGRFLLTGSSGSFQA THYPKPSETSVVCQWIIRVNQGLSIKLSFDDFNTYYTDILDIYEGVGSSKILRASIWETN PGTIRIFSNQVTATFLIESDESDYVGFNATYTAFNSSELNNYEKINCNFEDGFCFWVQDL NDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEP ACLSFWYHMYGENVHKLSINISNDQNMEKTVFQKEGNYGDNWNYGQVTLNETVKFKVAFN AFKNKILSDIALDDISLTYGICNGSLYPEPTLVPTPPPELPTDCGGPFELWEPNTTFSST NFPNSYPNLAFCVWILNAQKGKNIQLHFQEFDLENINDVVEIRDGEEADSLLLAVYTGPG PVKDVFSTTNRMTVLLITNDVLARGGFKANFTTGYHLGIPEPCKADHFQCKNGECVPLVN LCDGHLHCEDGSDEADCVRFFNGTTNNNGLVRFRIQSIWHTACAENWTTQISNDVCQLLG LGSGNSSKPIFPTDGGPFVKLNTAPDGHLILTPSQQCLQDSLIRLQCNHKSCGKKLAAQD ITPKIVGGSNAKEGAWPWVVGLYYGGRLLCGASLVSSDWLVSAAHCVYGRNLEPSKWTAI LGLHMKSNLTSPQTVPRLIDEIVINPHYNRRRKDNDIAMMHLEFKVNYTDYIQPICLPEE NQVFPPGRNCSIAGWGTVVYQGTTANILQEADVPLLSNERCQQQMPEYNITENMICAGYE EGGIDSCQGDSGGPLMCQENNRWFLAGVTSFGYKCALPNRPGVYARVSRFTEWIQSFLH |
| UniProt accession: P98073 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the recommended usage for immunoprecipitation with this goat anti-Agarose Immobilized ECS polyclonal antibody?
For immunoprecipitation (IP), it is recommended to use 15-25 µL of gel slurry per 0.1-1 mg of protein extract or lysate. Optimal concentrations should be determined by the end user for their specific applications.
How should this antibody be stored to maintain its stability?
This antibody is stable for at least one year when stored at 2-8°C in its supplied phosphate buffered saline (PBS) storage buffer containing 0.09% sodium azide.
Which host species and clonality characterize this antibody?
This antibody is a goat polyclonal antibody of the whole IgG isotype.
What is the immunogen used to generate this goat anti-Agarose Immobilized ECS polyclonal antibody?
The immunogen is a DDDDK peptide conjugated to keyhole limpet hemocyanin (KLH).
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.