Weight | 1 lbs |
---|---|
Dimensions | 9 × 5 × 2 in |
express system | HEK293 |
product tag | C-hFc-Avi |
purity | > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLC |
background | CD3E, is a single-pass type I membrane protein.CD3 (cluster of differentiation 3) T cell co-receptor helps to activate both the cytotoxic T cell (CD8 naive T cells) and also T helper cells (CD4 naive T cells). It consists of a protein complex and is composed of four distinct chains. In mammals, the complex contains a CD3γ chain, a CD3δ chain, and two CD3ε chains. |
molecular weight | The protein has a predicted MW of 31.3 kDa. Due to glycosylation, the protein migrates to 40-50 kDa based on Tris-Bis PAGE result. |
available size | 100 µg, 500 µg |
endotoxin | Less than 1EU per μg by the LAL method. |
Biotinylated Cynomolgus CD3E/CD3 epsilon 1-27 Protein 4197
$600.00 – $2,000.00
Summary
- Expression: HEK293
- Functional: Yes (ELISA)
- Amino Acid Range: Asp22-Thr48
Biotinylated Cynomolgus CD3E/CD3 epsilon 1-27 Protein 4197
protein |
---|
Size and concentration 100, 500µg and lyophilized |
Form Lyophilized |
Storage Instructions Valid for 12 months from date of receipt when stored at -80°C. Recommend to aliquot the protein into smaller quantities for optimal storage. Please minimize freeze-thaw cycles. |
Storage buffer Shipped at ambient temperature. |
Purity > 95% as determined by Tris-Bis PAGE |
target relevance |
---|
CD3E, is a single-pass type I membrane protein.CD3 (cluster of differentiation 3) T cell co-receptor helps to activate both the cytotoxic T cell (CD8 naive T cells) and also T helper cells (CD4 naive T cells). It consists of a protein complex and is composed of four distinct chains. In mammals, the complex contains a CD3γ chain, a CD3δ chain, and two CD3ε chains. |
Protein names T-cell surface glycoprotein CD3 epsilon chain (CD antigen CD3e) |
Gene names CD3E,CD3E |
Mass 22149Da |
Catalytic activity CD3E |
Pathway 9541 |
Subellular location CD3E |
Domain MQSGTRWRVLGLCLLSIGVWGQDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDVMAVATIVIVDICITLGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQQDLYSGLNQRRI |
Target Relevance information above includes information from UniProt accession: Q95LI5 |
The UniProt Consortium |
Data
Publications
Publications
pmid | title | authors | citation |
---|---|---|---|
We haven't added any publications to our database yet. |
Protocols
relevant to this product |
---|
Documents
# | ||
---|---|---|
Please enter your product and batch number here to retrieve product datasheet, SDS, and QC information. |