Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of HCC-1. Responses are expressed as the % of total input cells.

Hemofiltrate CC chemokine-1 (HCC-1/CCL14) 6008

$61.00 – $2,189.00

Summary

Expression: E.coli
Amino Acid Range: 28-93

SKU: 6008parent Categories: chemokine, proteins Tag: CCL14 (HCC-1)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	Q16627
express system	E.coli
product tag	none
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 7.801 kDa Extinction Coefficient: 13,850 M-1 cm-1 Actual Molecular Mass: 7.801 kDa by ESI Mass Spec
available size	100 µg, 1mg, 20 µg, 5 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method
sequence	GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKR GHSVCTN PSDKWVQDYIKDMKEN

Hemofiltrate CC chemokine-1 (HCC-1/CCL14)&

protein
Database link: human Q16627
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Hemofiltrate CC chemokine-1(HCC-1/CCL14) is endogeneously expressed by numerous tissues. Upon processing of the N terminal residues of the full length HCC-1 by the uPA-plasmin system, the active form of HCC-1 is a strong agonist for CCR1, CCR5 and to a lesser extent CCR3, and causes chemotaxis of different types of leukocytes. The active form of HCC-1 is also shown as a potent inhibitor of HIV entry.
Protein names C-C motif chemokine 14 (Chemokine CC-1/CC-3) (HCC-1/HCC-3) (HCC-1(1-74)) (NCC-2) (Small-inducible cytokine A14) [Cleaved into: HCC-1(3-74); HCC-1(4-74); HCC-1(9-74)]
Gene names CCL14,CCL14 NCC2 SCYA14
Protein family Intercrine beta (chemokine CC) family
Mass 10678Da
Function Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induces intracellular Ca(2+) changes and enzyme release, but no chemotaxis, at concentrations of 100-1,000 nM, and is inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1(9-74) is a chemotactic factor that attracts monocytes, eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5.
Subellular location Secreted.
Tissues Expressed constitutively in several normal tissues: spleen, liver, skeletal and heart muscle, gut, and bone marrow, present at high concentrations (1-80 nM) in plasma.
Post-translational modification The N-terminal processed forms HCC-1(3-74), HCC-1(4-74) and HCC-1(9-74) are produced in small amounts by proteolytic cleavage after secretion in blood.; HCC-1(1-74), but not HCC-1(3-74) and HCC-1(4-74), is partially O-glycosylated; the O-linked glycan consists of one Gal-GalNAc disaccharide, further modified by two N-acetylneuraminic acids.
Target Relevance information above includes information from UniProt accession: Q16627
The UniProt Consortium

Data

Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of HCC-1. Responses are expressed as the % of total input cells.

Publications

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.