Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of HCC-1. Responses are expressed as the % of total input cells.

Hemofiltrate CC chemokine-1 (HCC-1/CCL14) 6008

Price range: $61.00 through $2,189.00

Summary

Expression: E.coli
Amino Acid Range: 28-93

available size

Clear

SKU: 6008parent Categories: chemokine, proteins Tag: CCL14 (HCC-1)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	Q16627
express system	E.coli
product tag	none
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 7.801 kDa Extinction Coefficient: 13,850 M-1 cm-1 Actual Molecular Mass: 7.801 kDa by ESI Mass Spec
available size	100 µg, 1mg, 20 µg, 5 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method
sequence	GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKR GHSVCTN PSDKWVQDYIKDMKEN

Hemofiltrate CC chemokine-1 (HCC-1/CCL14)&

antibody
Database link: human Q16627
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Homo sapiens CCL14 C-C motif chemokine 14
Protein names C-C motif chemokine 14
Alternative names Chemokine CC-1/CC-3, HCC-1(1-74), NCC-2, Small-inducible cytokine A14
Gene names CCL14
Protein family Belongs to the intercrine beta (chemokine CC) family
Function Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induces intracellular Ca(2+) changes and enzyme release, but no chemotaxis, at concentrations of 100-1,000 nM, and is inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1(9-74) is a chemotactic factor that attracts monocytes, eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5
Subcellular location Secreted
Post-translational modification The N-terminal processed forms HCC-1(3-74), HCC-1(4-74) and HCC-1(9-74) are produced in small amounts by proteolytic cleavage after secretion in blood HCC-1(1-74), but not HCC-1(3-74) and HCC-1(4-74), is partially O-glycosylated; the O-linked glycan consists of one Gal-GalNAc disaccharide, further modified by two N-acetylneuraminic acids
Keywords 3D-structure, Alternative splicing, Cytokine, Direct protein sequencing, Disulfide bond, Glycoprotein, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCS KPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
UniProt accession: Q16627

Data

Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of HCC-1. Responses are expressed as the % of total input cells.

FAQ & Publications

Frequently Asked Questions

What is the source and expression system for Hemofiltrate CC chemokine-1 (HCC-1/CCL14)?

Hemofiltrate CC chemokine-1 (HCC-1/CCL14) is expressed in Escherichia coli (E.coli) expression system.

What are the recommended storage conditions for this lyophilized protein to maintain its stability?

The lyophilized protein should be stored at -20 to -70 °C to maintain stability for up to 12 months. After reconstitution, it can be kept for 1 month at 2 to 8 °C under sterile conditions or for 3 months at -20 to -70 °C under sterile conditions. Repeated freeze-thaw cycles should be avoided.

What purity level does this Hemofiltrate CC chemokine-1 product have and how is it verified?

The product has a purity greater than 97%, as confirmed by SDS-PAGE and HPLC analyses.

Which receptors does the active form of HCC-1 primarily target, and what is its biological relevance?

The active form of HCC-1 is a strong agonist for CCR1 and CCR5 receptors, and to a lesser extent CCR3. It induces chemotaxis of various leukocytes and acts as a potent inhibitor of HIV entry.

In what forms and sizes is Hemofiltrate CC chemokine-1 available for purchase?

Hemofiltrate CC chemokine-1 is available lyophilized in sizes of 5 µg, 20 µg, 50 µg, 100 µg, and 1 mg.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.